« Zurück
Home /
Recombinant Human Filaggrin(FLG),partial

Recombinant Human Filaggrin(FLG),partial

ArtNr	CSB-EP008712HU-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P20930
Gene Names	FLG
Organism	Homo sapiens (Human)
AA Sequence	DSSRHSQSGQGESAGSRRSRRQGSSVSQDSDSEAY PEDSERRSESASRNHHGSSREQSRDGSRHPGSSHR DTASHVQSSPVQSDSSTAKEHGHFSSLSQDSAYHS GIQSRGSPHSSSSYHYQSEGTERQKGQSGLVWRHG SYGSADYDYGESGFRHSQHGSVSYNSNPVVFKERS DICKASAFGKDHPRYYATYINKDPGLCGHSSDISK QLGFSQSQRYYYYE
Expression Region	3838-4061aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	40.8 kDa
Relevance	Aggregates keratin intermediate filaments and promotes disulfide-bond formation among the intermediate filaments during terminal differentiation of mammalian epidermis.
Reference	An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Aggregates keratin intermediate filaments and promotes disulfide-bond formation among the intermediate filaments during terminal differentiation of mammalian epidermis.
Involvement in disease	Ichthyosis vulgaris (VI); Dermatitis atopic 2 (ATOD2)
Subcellular Location	Cytoplasmic granule
Protein Families	S100-fused protein family
Tissue Specificity	Expressed in skin, thymus, stomach, tonsils, testis, placenta, kidney, pancreas, mammary gland, bladder, thyroid, salivary gland and trachea, but not detected in heart, brain, liver, lung, bone marrow, small intestine, spleen, prostate, colon, or adrenal gland (PubMed:19384417). In the skin, mainly expressed in stratum granulosum of the epidermis (PubMed:1429717) (PubMed:19384417).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen