ArtNr |
CSB-EP007243HU-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
MKP-1-like protein tyrosine phosphatase,Short name:,MKP-L,Mitogen-activated protein kinase phosphatase 6,Short name:,MAP kinase phosphatase 6,Short name:,MKP-6 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
O95147 |
Gene Names |
DUSP14 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLF LGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHG ATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQ TPYGIVPDVYEKESRHLMPYWGI |
Expression Region |
1-198aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
38.3 kDa |
Alternative Name(s) |
MKP-1-like protein tyrosine phosphatase Short name: MKP-L Mitogen-activated protein kinase phosphatase 6 Short name: MAP kinase phosphatase 6 Short name: MKP-6 |
Relevance |
Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases. |
Reference |
"Overproduction, purification and structure determination of human dual-specificity phosphatase 14."Lountos G.T., Tropea J.E., Cherry S., Waugh D.S.Acta Crystallogr. D 65:1013-1020(2009) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.