« Zurück
Home /
Recombinant Human Carbonic anhydrase 2(CA2)

Recombinant Human Carbonic anhydrase 2(CA2)

ArtNr	CSB-EP004370HU-500
Hersteller	Cusabio
Menge	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Carbonate dehydratase II;Carbonic anhydrase C ;CAC;Carbonic anhydrase II ;CA-II
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P00918
Gene Names	CA2
Organism	Homo sapiens (Human)
AA Sequence	SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTH TAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFD DSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSE HTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLA VLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFT NFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVL KEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRP AQPLKNRQIKASFK
Expression Region	2-260aa
Sequence Info	Full Length of BC011949
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	45.1 kDa
Alternative Name(s)	Carbonate dehydratase II; Carbonic anhydrase C ; CAC; Carbonic anhydrase II ; CA-II
Relevance	Essential for bone resorption and osteoclast differentiation . Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.3 Publications
Reference	Nucleotide sequence of human liver carbonic anhydrase II cDNA.Montgomery J.C., Venta P.J., Tashian R.E., Hewett-Emmett D.Nucleic Acids Res. 15:4687-4687(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential for bone resorption and osteoclast differentiation (By similarity). Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.
Involvement in disease	Osteopetrosis, autosomal recessive 3 (OPTB3)
Subcellular Location	Cytoplasm, Cell membrane
Protein Families	Alpha-carbonic anhydrase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP004370HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen