Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Format |
Lyophilized powder |
Menge |
500ug |
ArtNr |
CSB-AP005751HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Purity |
Greater than 95% as determined by SDS-PAGE. |
Classification |
Other Recombinant Protein |
Subdivision |
Others |
Research Areas |
Cancer |
Uniprot NO. |
P02751 |
Gene Names |
FN1 |
Source |
E.coli |
Expression Region |
1270-1546aa & 1721-2016aa |
Sequence |
PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSP VKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVS SVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSF TVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQ STVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYR ITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDY TITVYAVTGRGDSPASSKPISINYRTEIDKPS & AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVR VTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEV SVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDA TETTITIS WRTKTETITGFQVDAVPANGQTPIQR TIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSP VVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRAR ITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLE PGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVT LPHPNLHGPEILDVPST |
Protein Description |
Dimer |
Tag Info |
Tag-Free |
Mol. Weight |
62.7 kDa |
Biological Activity |
Specific activity as determined by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells is greater than 50%. When 1x10^5 cells/well are added to plates coated with fibronectin (7-13 ng/mL and 100uL/well), approximately 50%-80% will adhere specifically after 30 minutes at 37C. |
Purity |
Greater than 95% as determined by SDS-PAGE. |
Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
Storage Buffer |
Lyophilized from a 0.2 um Filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2 |
Alias |
NovoNectin; Fibronectin; FN; Cold-insoluble globulin; CIG; FN; Fibronectin 1 |
Relevance |
Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains, fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of ca.63 kDa containing a central cell-binding domain, a high affinity heparin-binding domain II, and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on NovoNectin. This process enhances the density of both cells and vectors, and facilitates the gene transduction in the result. |
Function |
Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.; FUNCTION |
Involvement in disease |
Glomerulopathy with fibronectin deposits 2 (GFND2) |
Subcellular Location |
Secreted, extracellular space, extracellular matrix |
Tissue Specificity |
Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine. |
Paythway |
PI3K-Aktsignalingpathway |
Tag Information |
Tag-Free |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.