ArtNr |
CSB-AP005541HU-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Quantity options |
1mg
10ug
50ug
500ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized powder |
Specific against |
Human |
Purity |
Greater than 95% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Classification |
Other Recombinant Protein |
Subdivision |
Others |
Research Areas |
Signal Transduction |
Uniprot NO. |
P10599 |
Gene Names |
TXN |
Source |
E.coli |
Expression Region |
1-105aa |
Sequence |
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPC KMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
Protein Description |
Full Length |
Tag Info |
N-terminal 6xHis-tagged |
Mol. Weight |
13.9 kDa |
Biological Activity |
Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg. |
Purity |
Greater than 95% as determined by SDS-PAGE. |
Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
Storage Buffer |
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Alias |
Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1 |
Relevance |
Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. |
Function |
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION |
Subcellular Location |
Nucleus, Cytoplasm, Secreted |
Protein Families |
Thioredoxin family |
Paythway |
NOD-likereceptorsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.