Recombinant Human Thioredoxin(TXN) (Active)

Others

P10599

E.coli

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPC KMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

N-terminal 6xHis-tagged

Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg.

Less than 1.0 EU/ug as determined by LAL method.

Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION

Thioredoxin family

N-terminal 6xHis-tagged