ArtNr |
CSB-AP005441HU-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized powder |
Specific against |
Human |
Purity |
Greater than 95% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Classification |
Other Recombinant Protein |
Subdivision |
Others |
Research Areas |
Immunology |
Uniprot NO. |
O95727 |
Gene Names |
CRTAM |
Source |
Mammalian cell |
Expression Region |
18-286aa |
Sequence |
SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLT PSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPN VTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPI LEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLG NSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNS TVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDA LERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKE QTTQDPDLTTEANPQYLGLARKKS |
Protein Description |
Partial |
Tag Info |
C-terminal 6xHis-tagged |
Mol. Weight |
30.99 kDa |
Biological Activity |
The ED50 as determined by its ability to bind Human CADM1 in functional ELISA is less than 20 ug/ml. |
Purity |
Greater than 95% as determined by SDS-PAGE. |
Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
Storage Buffer |
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Alias |
Cytotoxic and Regulatory T-Cell Molecule; Class-I MHC-Restricted T-Cell-Associated Molecule; CD355; CRTAM |
Relevance |
Cytotoxic and Regulatory T-Cell Molecule (CRTAM) is a member of Nectin family under the immunoglobulin superfamily that is expressed by activated CD8+ and NK T cells. CRTAM is found in spleen, thymus, small intestine, peripheral blood, and it is highly expressed by Purkinje cells of the cerebellum. CRTAM is a type I transmembrane glycoprotein containing one Ig-like C2-type domain and one Ig-like V-type domain in its extracellular domain, while its cytoplasmic region shows a potential class I PDZ domain. CRTAM is expressed as a homodimer on the cell surface but does not show homotypic binding in trans. The high affinity of CRTAM/IGSF4 adhesion allows CRTAM to disrupt IGSF4 homotypic interactions. IGSF4 and T cell receptor coengagement of CD8+ cells expressiong CRTAM induces increased IFNgamma or IL-22 production. |
Function |
Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Protein Families |
Nectin family |
Tissue Specificity |
In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 cells. Strongly expressed in spleen, thymus, small intestine, peripheral blood leukocyte, and in Purkinje neurons in cerebellum. Expressed at much lower levels in testis, ovary, colon, lung and lymphoid tissues. |
Tag Information |
C-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.