ArtNr |
CSB-AP004971HU-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Classification |
Cytokine |
Subdivision |
Tumor Necrosis Factor |
Research Areas |
Cancer |
Uniprot NO. |
P19438 |
Gene Names |
TNFRSF1A |
Source |
E.coli |
Expression Region |
22-211aa |
Sequence |
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNS ICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTA SENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCG CRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEK QNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCL PQIENVKGTEDSGTT |
Protein Description |
Partial |
Tag Info |
N-terminal 6xHis-tagged |
Mol. Weight |
23.5 kDa |
Biological Activity |
The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L?929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D. |
Purity |
Greater than 95% as determined by SDS-PAGE. |
Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
Storage Buffer |
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4 |
Alias |
Tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; TNFAR; TNFR1 |
Relevance |
Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome |
Function |
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. |
Involvement in disease |
Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5) |
Subcellular Location |
Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted |
Paythway |
MAPKsignalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.