ArtNr |
CSB-AP004851HU-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized powder |
Specific against |
Human |
Konjugat/Tag |
Tag Free |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Classification |
Cytokine |
Subdivision |
Tumor Necrosis Factor |
Research Areas |
Cancer |
Uniprot NO. |
O14788 |
Gene Names |
TNFSF11 |
Source |
E.coli |
Expression Region |
140-317aa |
Sequence |
IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATD IPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVN QDGFYYLYANICFRHHETSGDLATEYLQLMVYVTK TSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGG FFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVR DID |
Protein Description |
Partial |
Tag Info |
N-terminal 6xHis-tagged |
Mol. Weight |
22.4 kDa |
Biological Activity |
The ED50 as determined by its ability to binding SF11A used funtional ELISA is less than 10 ug/ml. |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
Storage Buffer |
Lyophilized from a 0.2 um Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
Alias |
CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteoclast differentiation factor; Receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor ligand superfamily member 11 |
Relevance |
CD254, also known as RANKL, TNFSF11, TRANCE, OPGL and ODF, is a type II membrane protein of the tumor necrosis factor (TNF) superfamily, and affects the immune system and control bone regeneration and remodeling. RANKL is the ligand of nuclear factor (NF)-kappaB (RANK). When RANKL binds to RANK, it will undergo trimerization and then bind to an adaptor molecule TNF receptor-associated factor 6 (TRAF6). This results in the activation of several downstream signaling cascades, including the NFkappaB, mitogen-activated protein kinases (MAPK), activating protein 1 (AP-1), and nuclear factor of activated T cells (NFATc1), resulting in the formation of multinucleated bone-resorbing osteoclasts. RANKL is widely expressed in skeletal muscle, thymus, liver, colon, small intestine, adrenal gland, osteoblast, mammary gland epithelial cells, prostate and pancreas. |
Function |
Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy |
Involvement in disease |
Osteopetrosis, autosomal recessive 2 (OPTB2) |
Subcellular Location |
Isoform 1: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 11, soluble form: Secreted |
Protein Families |
Tumor necrosis factor family |
Tissue Specificity |
Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. |
Paythway |
NF-kappaBsignalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.