« Zurück
Home /
Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)

Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)

ArtNr	CSB-AP004411HU-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Classification	Cytokine
Subdivision	Interleukin
Research Areas	Immunology
Uniprot NO.	Q9UBH0
Gene Names	IL36RN
Source	E.coli
Expression Region	1-155aa
Sequence	MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGK VIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDM GLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD
Protein Description	Full Length
Tag Info	Tag-Free
Mol. Weight	16.9 kDa
Biological Activity	The ED50 as determined by its ability to inhibit IL-36 alpha, IL-36 beta or IL-36 gamma -induced IL-8 secretion in A431 human epithelial carcinoma cells is less than 500 ng/ml in the presence of 10 ng/mL of recombinant human IL-36 beta.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Alias	Interleukin-36 Receptor Antagonist Protein; FIL1 Delta; IL-1-Related Protein 3; IL-1RP3; Interleukin-1 HY1; IL-1HY1; Interleukin-1 Delta; IL-1 Delta; Interleukin-1 Family Member 5; IL-1F5; Interleukin-1 Receptor Antagonist Homolog 1; IL-1ra Homolog 1; Interleukin-1-Like Protein 1; IL-1L1; IL36RN; FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3
Relevance	Human Interleukin-36 Receptor Antagonist (IL-36RN) is a secreted protein which belongs to the Interleukin 1 cytokine family (IL-1 family). IL-36RN is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RN is also detected in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. IL-36RN is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to Interleukin 1 family member 9 (IL1F9). Dysregulated expression of novel agonistic and antagonistic IL-1 family member ligands can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. Human and mouse IL-36RN share 90% sequence identity.
Function	Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Involvement in disease	Psoriasis 14, pustular (PSORS14)
Subcellular Location	Secreted
Protein Families	IL-1 family
Tissue Specificity	Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

nicht lieferbar