« Zurück
Home /
Recombinant Chicken Collagen alpha-1(XII) chain(COL12A1),partial

Recombinant Chicken Collagen alpha-1(XII) chain(COL12A1),partial

ArtNr	CSB-YP005719CH-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibrochimerin
Lieferbar
Research Topic	Others
Uniprot ID	P13944
Gene Names	COL12A1
Organism	Gallus gallus (Chicken)
AA Sequence	DLVFLVDGSWSVGRNNFRYILDFMVALVSAFDIGE EKTRVGVVQYSSDTRTEFNLNQYFRRSDLLDAIKR IPYKGGNTMTGEAIDYLVKNTFTESAGARKGFPKV AIVITDGKAQDEVEIPARELRNIGVEVFSLGIKAA DAKELKLIASQPSLKHVFNVANFDGIVDIQNEI
Expression Region	139-311aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	21.3 kDa
Alternative Name(s)	Fibrochimerin
Relevance	Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix.
Reference	The complete primary structure of type XII collagen shows a chimeric molecule with reiterated fibronectin type III motifs, von Willebrand factor A motifs, a domain homologous to a noncollagenous region of type IX collagen, and short collagenous domains with an Arg-Gly-Asp site.Yamagata M., Yamada K.M., Yamada S.S., Shinomura T., Tanaka H., Nishida Y., Obara M., Kimata K.J. Cell Biol. 115:209-221(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix.
Subcellular Location	Secreted, extracellular space, extracellular matrix
Protein Families	Fibril-associated collagens with interrupted helices (FACIT) family
Tissue Specificity	Type XII collagen is present in tendons, ligaments, perichondrium, and periosteum, all dense connective tissues containing type I collagen.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP005719CH-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen