« Zurück
Home /
Recombinant Dog Interleukin-8(IL8)

Recombinant Dog Interleukin-8(IL8)

ArtNr	CSB-YP011671DO-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Neuroscience Neuroinflammation Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
Lieferbar
Research Topic	Others
Uniprot ID	P41324
Gene Names	IL8
Organism	Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence	AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDS GPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIF LKKAEKQDP
Expression Region	23-101aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	11.1 kDa
Alternative Name(s)	C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
Relevance	IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Reference	Cloning of a canine gene homologous to the human interleukin-8-encoding gene.Ishikawa J., Suzuki S., Hotta K., Hirota Y., Mizuno S., Suzuki K.Gene 131:305-306(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Subcellular Location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen