ArtNr |
CSB-YP011659DO-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Quantity options |
1mg
10ug
100ug
200ug
50ug
500ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Host |
Yeast |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Alternative Name(s) |
B-cell stimulatory factor 1 ; BSF-1Lymphocyte stimulatory factor 1 |
AA Sequence |
HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTA PKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYR NLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKY YRH |
Research Topic |
Others |
Uniprot ID |
O77762 |
Gene Names |
IL4 |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
25-132aa |
MW of Fusion Proten |
14, 8 |
Sequence Info |
Full Length |
Relevance |
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes . |
Reference |
Molecular cloning and sequencing of the cDNA for dog interleukin-4.van der Kaaij S.Y., Pinelli E., Broeren C.P.M., Schetters T.P.M., Haghparast A., Ruitenberg E.J., Rutten V.P.M.G.Immunogenetics 49:142-143(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Species |
Canis lupus familiaris (Dog) (Canis familiaris) |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.