« Zurück
Home /
Recombinant Dog Interleukin-4(IL4)

Recombinant Dog Interleukin-4(IL4)

ArtNr	CSB-YP011659DO-1
Hersteller	Cusabio
Menge	1mg
Quantity options	1mg 10ug 100ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Alternative Name(s)	B-cell stimulatory factor 1 ; BSF-1Lymphocyte stimulatory factor 1
AA Sequence	HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTA PKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYR NLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKY YRH
Research Topic	Others
Uniprot ID	O77762
Gene Names	IL4
Tag Info	N-terminal 6xHis-tagged
Expression Region	25-132aa
MW of Fusion Proten	14, 8
Sequence Info	Full Length
Relevance	Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes .
Reference	Molecular cloning and sequencing of the cDNA for dog interleukin-4.van der Kaaij S.Y., Pinelli E., Broeren C.P.M., Schetters T.P.M., Haghparast A., Ruitenberg E.J., Rutten V.P.M.G.Immunogenetics 49:142-143(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Canis lupus familiaris (Dog) (Canis familiaris)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen