« Zurück
Home /
Recombinant Human Beta-2 adrenergic receptor(ADRB2)(G16R,E27Q)-VLPs

Recombinant Human Beta-2 adrenergic receptor(ADRB2)(G16R,E27Q)-VLPs

ArtNr	CSB-MP001392HU(M)-1mg
Hersteller	Cusabio
Menge	1 mg
Quantity options	100 ug 1 mg 20 ug
Typ	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human (Homo sapiens)
Konjugat/Tag	HIS
Purity	The purity information is not available for VLPs proteins.
Sequence	MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTG
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-2 adrenoreceptor;Beta-2 adrenoceptor
Lieferbar
Manufacturer - Category	MP-VLP Transmembrane Protein & Developed Protein
Manufacturer - Conjugate / Tag	C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20â„ƒ/-80â„ƒ. The shelf life of lyophilized form is 12 months at -20â„ƒ/-80â„ƒ.
Molecular Weight	47.8 kDa
Buffer	Lyophilized from a 0.2 Î¼m filtered PBS, 6% Trehalose, pH 7.4.
General Research Areas	Cardiovascular
Relevance	Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Expression Region	1-413aa(G16R, E27Q)
Protein Length	Full Length
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80â„ƒ. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Notes	The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20â„ƒ/-80â„ƒ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Gene Names	ADRB2
Transmembrane Domain	7TM

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 22.05.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail