« Zurück
Home /
Anti-Cardiac FABP/FABP3 Antibody

Anti-Cardiac FABP/FABP3 Antibody

ArtNr	BOS-PB9759
Hersteller	Boster
Menge	100 ug/vial
Kategorie	Oncology Metabolism Glucose Homeostasis Antibodies Obesity Immunohistochemistry Western Blot Primary Antibodies By Organ Breast Cancer
Typ	Antibody Polyclonal
Format	Lyophilized
Applikationen	WB, IHC
Specific against	Human, Mouse, Rat
Host	Rabbit
Isotype	IgG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Fatty acid-binding protein, heart;Fatty acid-binding protein 3;Heart-type fatty acid-binding protein;H-FABP;Mammary-derived growth inhibitor;MDGI;Muscle fatty acid-binding protein;M-FABP;FABP3;FABP11, MDGI;
Lieferbar
Background	Heart-type fatty acid binding protein (hFABP), also known as mammary-derived growth inhibitor, is a protein that in humans is encoded by the FABP3 gene. The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is also a candidate tumor suppressor gene for human breast cancer. Cardiac-type fatty acid-binding protein (cFABP) from human heart muscle of three individuals was isolated and characterized as pI 5.3-cFABP.
Concentration	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Cross reactivity	No cross reactivity with other proteins.
Description	Rabbit IgG polyclonal antibody for Fatty acid-binding protein, heart(FABP3) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Gene full name	Fatty acid-binding protein, heart
Gene name	FABP3
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human Cardiac FABP (15-48aa KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD), identical to the related mouse and rat sequences.
MW	14858 MW
Predicted reactivity	Hamster
Protein function	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Protein name	Fatty acid-binding protein, heart
Purification	Immunogen affinity purified.
Recommended detection ystems	Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Research category	\|cardiovascular\|lipids / lipoproteins\|fatty acids\|binding proteins\| stem cells\|mesenchymal stem cells\|myogenesis\| metabolism\|pathways and processes\|metabolic signaling pathways\|lipid and lipoprotein metabolism\|redox metabolism\|fatty acid oxidation
Storage	At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time.Avoid repeated freezing and thawing.
Subcellular localization	Cytoplasm.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.