ArtNr |
BM-RPC26951-50ug |
Hersteller |
Biomatik
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Rabbit |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFA, TNFSF2 |
Similar products |
TNF, TNF-a, TNFA, TNFSF2, Cachectin, TNF-Alpha, Tumor Necrosis Factor, Tumor Necrosis Factor Ligand Superfamily Member 2 |
Lieferbar |
|
Gene Name |
TNF |
Alternative Names |
Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFA, TNFSF2 |
Uniprot |
P04924 |
Source |
E.coli |
Expression Region |
77-235aa |
AA Sequence |
MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQR ANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQ GCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHR ETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQ PEYLDLAESGQVYFGIIAL |
Sequence Info |
Partial |
Tag Info |
Tag-Free |
Theoretical MW |
17.59 kDa |
Purity |
>95% as determined by SDS-PAGE. |
Storage Buffer |
Lyophilized from a 0.2 um filtered 20 mM PB, 300 mM NaCl, pH 7.4 |
Endotoxin Level |
Less than 1.0 EU/ug as determined by LAL method. |
Biological Activity |
The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells is less than 20 pg/ml in the presence of the metabolic inhibitor actinomycin D. |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Tumor necrosis factor alpha (TNFalpha) is the prototypic ligand of the TNF superfamily. TNFalpha forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1, p55R) and TNF-R2 (TNF receptor type 2, p75R). TNFalpha is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFalpha is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells. |
Function |
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION |
Subcellular location |
Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted |
Protein Families |
Tumor necrosis factor family |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.