« Zurück
Home /
Recombinant Pig Rhodopsin (RHO), partial

Recombinant Pig Rhodopsin (RHO), partial

ArtNr	BM-RPC25714-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Porcine
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RHO1
Similar products	RHO1
Lieferbar
Gene Name	RHO
Alternative Names	RHO1
Uniprot	O18766
Source	E.coli
Expression Region	1-36aa
AA Sequence	MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPW
Sequence Info	Partial
Tag Info	N-terminal GST-tagged
Theoretical MW	31.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling
Function	Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Subcellular location	Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families	G-protein coupled receptor 1 family, Opsin subfamily

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 24.04.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail