« Zurück
Home /
Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial

Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial

ArtNr	BM-RPC26121-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Gene Name	CHRNA1
Uniprot	P02710
Source	Yeast
Expression Region	25-234aa
AA Sequence	SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGL QLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPA DYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHM TKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQ NCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGE WVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Sequence Info	Partial
Tag Info	N-terminal 6xHis-sumostar-tagged
Theoretical MW	37.9 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular location	Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 24.04.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail