« Zurück
Home /
Recombinant Streptomyces globisporus Lysozyme M1 (acm)

Recombinant Streptomyces globisporus Lysozyme M1 (acm)

ArtNr	BM-RPC25984-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins Cardiovascular Research Hypertension
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	1,4-beta-N-acetylmuramidase M1
Similar products	1, 4-beta-N-acetylmuramidase M1
Lieferbar
Gene Name	acm
Alternative Names	1, 4-beta-N-acetylmuramidase M1
Uniprot	P25310
Source	E.coli
Expression Region	78-294aa
AA Sequence	DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKAT EGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNAS SGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSG AMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTT ASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSG FPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLL ALANNTA
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	30.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.
Function	This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.
Subcellular location	Secreted, extracellular space
Protein Families	Glycosyl hydrolase 25 family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 14 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail