ArtNr |
BM-RPC25937-1mg |
Hersteller |
Biomatik
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Nucleocapsid protein Short name: NP Short name: Protein N |
Similar products |
Nucleocapsid protein Short name: NP Short name: Protein N |
Lieferbar |
|
Gene Name |
N |
Alternative Names |
Nucleocapsid protein Short name: NP Short name: Protein N |
Uniprot |
B8PZP3 |
Source |
E.coli |
Expression Region |
1-400aa |
AA Sequence |
MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHII IVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLT GALIGILSLFVESPGQLIQRITDDPDVSIRLLEVV QSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSD QSRFGWFGNKEISDIEVQDPEGFNMILGTILAQIW VLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFR LERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPG NKPRIAEMICDIDTYIVEAGLASFILTIKFGIETM YPALGLHEFAGELSTLESLMNLYQQMGETAPYMVI LENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGL NFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELG ITAEDARLVSEIAMH |
Sequence Info |
Partial |
Tag Info |
N-terminal 10xHis-tagged |
Theoretical MW |
49.9 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure with either 12.35 or 11.64 N per turn, approximately 20 nm in diameter, with a hollow central cavity approximately 5 nm in diameter. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases. N is released in the blood following lysis of measles infected cells, it interacts then with human FCGR2B on immune cells, inducing apoptosis and blocking inflammatory immune response. Ntail binds to a protein on human thymic epithelial cells, termed Nucleoprotein Receptor (NR), inducing growth arrest |
Function |
Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure with either 12.35 or 11.64 N per turn, approximately 20 nm in diameter, with a hollow central cavity approximately 5 nm in diameter. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases. N is released in the blood following lysis of measles infected cells, it interacts then with human FCGR2B on immune cells, inducing apoptosis and blocking inflammatory immune response. Ntail binds to a protein on human thymic epithelial cells, termed Nucleoprotein Receptor (NR), inducing growth arrest (By similarity). |
Subcellular location |
Virion, Host cytoplasm |
Protein Families |
Paramyxoviruses nucleocapsid family |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.