« Zurück
Home /
Recombinant Neosartorya fumigata Vacuolar protease A (pep2)

Recombinant Neosartorya fumigata Vacuolar protease A (pep2)

ArtNr	BM-RPC25823-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cardiovascular Research Heart Failure Myocardial Infarction
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Aspartic endopeptidase pep2 (Aspartic protease pep2)
Similar products	Aspartic endopeptidase pep2 (Aspartic protease pep2)
Lieferbar
Gene Name	pep2
Alternative Names	Aspartic endopeptidase pep2 (Aspartic protease pep2)
Uniprot	O42630
Source	E.coli
Expression Region	71-398aa
AA Sequence	SRHDVLVDNFLNAQYFSEISLGTPPQKFKVVLDTG SSNLWVPGSDCSSIACFLHNKYDSSASSTYKANGT EFAIKYGSGELSGFVSQDTLQIGDLKVVKQDFAEA TNEPGLAFAFGRFDGILGLGYDTISVNKIVPPFYN MLDQGLLDEPVFAFYLGDTNKEGDNSEASFGGVDK NHYTGELTKIPLRRKAYWEVDFDAIALGDNVAELE NTGIILDTGTSLIALPSTLADLLNKEIGAKKGFTG QYSIECDKRDSLPDLTFTLAGHNFTIGPYDYTLEV QGSCISSFMGMDFPEPVGPLAILGDAFLRKWYSVY DLGNNAVGLAKAK
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	39.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Vacuolar aspartic endopeptidase which is probably also secreted and contributes to virulence.
Function	Vacuolar aspartic endopeptidase which is probably also secreted and contributes to virulence.
Subcellular location	Vacuole lumen, Secreted
Protein Families	Peptidase A1 family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 24.04.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail