« Zurück
Home /
Recombinant Vaccinia virus Protein L1 (VACWR088), partial

Recombinant Vaccinia virus Protein L1 (VACWR088), partial

ArtNr	BM-RPC25715-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Virion membrane protein M25
Similar products	Virion membrane protein M25
Lieferbar
Gene Name	VACWR088
Alternative Names	Virion membrane protein M25
Uniprot	P07612
Source	E.coli
Expression Region	2-183aa
AA Sequence	GAAASIQTTVNTLSERISSKLEQEANASAQTKCDI EIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSA ATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVR DFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPG SPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAP KQVAGTG
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	24.8 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.
Function	Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.
Subcellular location	Virion membrane, Single-pass membrane protein
Protein Families	Chordopoxvirinae L1 family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 24.04.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail