« Zurück
Home /
Recombinant Macaca mulatta Interleukin-10 (IL10)

Recombinant Macaca mulatta Interleukin-10 (IL10)

ArtNr	BM-RPC20637-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytokine synthesis inhibitory factor
Similar products	Cytokine synthesis inhibitory factor
Lieferbar
Gene Name	IL10
Alternative Names	Cytokine synthesis inhibitory factor
Uniprot	P51496
Source	Baculovirus
Expression Region	19-178aa
AA Sequence	SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKT FFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQ FYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRL RRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAM SEFDIFINYIEAYMTMKIQN
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 10xHis-tagged
Theoretical MW	21.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Function	Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular location	Secreted
Protein Families	IL-10 family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 30.08.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern