« Zurück
Home /
Recombinant Mouse Tenascin (Tnc), partial

Recombinant Mouse Tenascin (Tnc), partial

ArtNr	BM-RPC26408-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Neuroscience Metabolism Diabetes Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Necrosis
Typ	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hexabrachion Tenascin-C Short name: TN-C Hxb
Similar products	Hexabrachion Tenascin-C Short name: TN-C Hxb
Lieferbar
Gene Name	Tnc
Alternative Names	Hexabrachion Tenascin-C Short name: TN-C Hxb
Uniprot	Q80YX1
Source	Mammalian cell
Expression Region	1884-2099aa
AA Sequence	GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQA LEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYA AGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDH GESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSM NYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNC HRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEM KLRPSN
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	28.8 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells
Function	Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8
Subcellular location	Secreted, extracellular space, extracellular matrix
Protein Families	Tenascin family
Tissue Specificity	Expressed in kidney, aortic valve, corneal limbus, periosteum around the ribs, cerebellum, stomach and intestine (PubMed:14709716). High levels of isoform 2 in lung and brain of newborn mice. High levels of isoform 5 in thymus, moderate levels in brain of newborn and adult mice. Low level of isoform 2 in adult brain.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 27.12.2024

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail