« Zurück
Home /
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

ArtNr	BM-RPC26327-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Glucose Homeostasis Neural Signaling By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Cell Stainings ECM
Typ	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Similar products	Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Lieferbar
Gene Name	C1qtnf3
Alternative Names	Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Uniprot	Q9ES30
Source	Baculovirus
Expression Region	23-246aa
AA Sequence	QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPG PPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDL GPRGERGQHGPKGEKGYPGVPPELQIAFMASLATH FSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGV YFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYET KGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQ RFSTFAGFLLFETK
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	26.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Subcellular location	Secreted

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 27.12.2024

Express-Lieferung: 10 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail