« Zurück
Home /
Recombinant Mouse Insulin-2 (Ins2)

Recombinant Mouse Insulin-2 (Ins2)

ArtNr	BM-RPC26242-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins Endocrine Regulation of Lipid Metabolism
Typ	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ins-2
Similar products	Ins-2
Lieferbar
Gene Name	Ins2
Alternative Names	Ins-2
Uniprot	P01326
Source	E.coli
Expression Region	25-110aa
AA Sequence	FVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVE DPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQ CCTSICSLYQLENYCN
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	16.9 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 17 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail