ArtNr |
BM-RPC26238-1mg |
Hersteller |
Biomatik
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5) |
Similar products |
cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5) |
Lieferbar |
|
Gene Name |
Pde5a |
Alternative Names |
cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5) |
Uniprot |
Q8CG03 |
Source |
E.coli |
Expression Region |
154-320aa |
AA Sequence |
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDK FLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHV AAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILC MPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDF AAYLAFCGIVLHNAQLYETSLLENKRN |
Sequence Info |
Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
26.1 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Specifically regulates nitric-oxide-generated cGMP. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.