ArtNr |
BM-RPC26223-1mg |
Hersteller |
Biomatik
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
78 kDa glucose-regulated protein (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) (Grp78) |
Similar products |
78 kDa glucose-regulated protein (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) (Grp78) |
Lieferbar |
|
Gene Name |
Hspa5 |
Alternative Names |
78 kDa glucose-regulated protein (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) (Grp78) |
Uniprot |
P20029 |
Source |
E.coli |
Expression Region |
20-655aa |
AA Sequence |
EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEII ANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP ENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKK TKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAE AYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGL NVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGG TFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVM EHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRA LSSQHQARIEIESFFEGEDFSETLTRAKFEELNMD LFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRI PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAG VLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIP RNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLT KDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGI LRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVN DAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGD KEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADI EDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDT SEKDEL |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
74.5 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Endoplasmic reticulum chaperone that plays a key role in protein folding and quality control in the endoplasmic reticulum lumen. Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10/ERdj5, probably to facilitate the release of DNAJC10/ERdj5 from its substrate. Acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response. In the unstressed endoplasmic reticulum, recruited by DNAJB9/ERdj4 to the luminal region of ERN1/IRE1, leading to disrupt the dimerization of ERN1/IRE1, thereby inactivating ERN1/IRE1. Accumulation of misfolded protein in the endoplasmic reticulum causes release of HSPA5/BiP from ERN1/IRE1, allowing homodimerization and subsequent activation of ERN1/IRE1. Plays an auxiliary role in post-translational transport of small presecretory proteins across endoplasmic reticulum. May function as an allosteric modulator for SEC61 channel-forming translocon complex, likely cooperating with SEC62 to enable the productive insertion of these precursors into SEC61 channel. Appears to specifically regulate translocation of precursors having inhibitory residues in their mature region that weaken channel gating. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.