« Zurück
Home /
Recombinant Mouse Sclerostin domain-containing protein 1 (Sostdc1)

Recombinant Mouse Sclerostin domain-containing protein 1 (Sostdc1)

ArtNr	BM-RPC25641-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ectodermal BMP inhibitor Short name: Ectodin Sclerostin-like protein Uterine sensitization-associated gene 1 protein Short name: USAG-1 Sostl, Usag1
Similar products	Ectodermal BMP inhibitor Short name: Ectodin Sclerostin-like protein Uterine sensitization-associated gene 1 protein Short name: USAG-1 Sostl, Usag1
Lieferbar
Gene Name	Sostdc1
Alternative Names	Ectodermal BMP inhibitor Short name: Ectodin Sclerostin-like protein Uterine sensitization-associated gene 1 protein Short name: USAG-1 Sostl, Usag1
Uniprot	Q9CQN4
Source	E.coli
Expression Region	24-206aa
AA Sequence	FKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGR HFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSIS PLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSS QEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTAC KCKRYTRQHNESSHNFESVSPAKPAQHHRERKRAS KSSKHSLS
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	27.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling. Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
Function	May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling (By similarity). Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
Subcellular location	Secreted
Protein Families	Sclerostin family
Tissue Specificity	Highly expressed in kidney at renal collecting ducts level and weakly in brain.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 28.02.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail