ArtNr |
BM-RPC25638-100ug |
Hersteller |
Biomatik
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cytolysin Lymphocyte pore-forming protein Short name: PFP |
Similar products |
Cytolysin Lymphocyte pore-forming protein Short name: PFP |
Lieferbar |
|
Gene Name |
Prf1 |
Alternative Names |
Cytolysin Lymphocyte pore-forming protein Short name: PFP |
Uniprot |
P10820 |
Source |
E.coli |
Expression Region |
21-554aa |
AA Sequence |
PCYTATRSECKQKHKFVPGVWMAGEGMDVTTLRRS GSFPVNTQRFLRPDRTCTLCKNSLMRDATQRLPVA ITHWRPHSSHCQRNVAAAKVHSTEGVAREAAANIN NDWRVGLDVNPRPEANMRASVAGSHSKVANFAAEK TYQDQYNFNSDTVECRMYSFRLVQKPPLHLDFKKA LRALPRNFNSSTEHAYHRLISSYGTHFITAVDLGG RISVLTALRTCQLTLNGLTADEVGDCLNVEAQVSI GAQASVSSEYKACEEKKKQHKMATSFHQTYRERHV EVLGGPLDSTHDLLFGNQATPEQFSTWTASLPSNP GLVDYSLEPLHTLLEEQNPKREALRQAISHYIMSR ARWQNCSRPCRSGQHKSSHDSCQCECQDSKVTNQD CCPRQRGLAHLVVSNFRAEHLWGDYTTATDAYLKV FFGGQEFRTGVVWNNNNPRWTDKMDFENVLLSTGG PLRVQVWDADYGWDDDLLGSCDRSPHSGFHEVTCE LNHGRVKFSYHAKCLPHLTGGTCLEYAPQGLLGDP PGNRSGAVW |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
63.9 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. |
Function |
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. |
Subcellular location |
Cytoplasmic granule lumen, Secreted, Cell membrane, Multi-pass membrane protein, Endosome lumen |
Protein Families |
Complement C6/C7/C8/C9 family |
Tissue Specificity |
Detected in cytotoxic T-lymphocytes and natural killer cells. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.