« Zurück
Home /
Recombinant Mouse Group XV phospholipase A2 (Pla2g15)

Recombinant Mouse Group XV phospholipase A2 (Pla2g15)

ArtNr	BM-RPC25613-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cardiovascular Research Thrombosis & Hemostasis Enzymes Fatty Acid Catabolism
Typ	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2
Similar products	1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2
Lieferbar
Gene Name	Pla2g15
Alternative Names	1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2
Uniprot	Q8VEB4
Source	E.coli
Expression Region	34-412aa
AA Sequence	AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKK TDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSR ATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYF YTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPY FLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFL QRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASG DNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSH EKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQD TEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFP DRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVS LQELPGSEHIEMLANATTLAYLKRVLLEP
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	50.5 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid. Has high activity with 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) and 1, 2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), catalyzing the transfer of oleic acid to N-acetyl-sphingosine. Required for normal phospholipid degradation in alveolar and peritoneal macrophages and in spleen
Function	Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid
Subcellular location	Secreted, Lysosome, Membrane, Peripheral membrane protein
Protein Families	AB hydrolase superfamily, Lipase family
Tissue Specificity	Detected in blood plasma (PubMed:20410020). Detected in alveolar macrophages (at protein level) (PubMed:16106046, PubMed:16880524, PubMed:19017977). Detected in heart, liver, spleen, kidney, thymus, brain and lung (PubMed:16880524).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 27.12.2024

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail