« Zurück
Home /
Recombinant Macaca fascicularis Legumain (LGMN)

Recombinant Macaca fascicularis Legumain (LGMN)

ArtNr	BM-RPC25657-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cardiovascular Research Heart Failure Myocardial Infarction
Typ	Proteins Recombinant
Specific against	Monkey (Cynomolgus, Simian)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Asparaginyl endopeptidase Protease, cysteine 1 Gene namesi Name:LGMN PRSC1
Similar products	Asparaginyl endopeptidase Protease, cysteine 1 Gene namesi Name:LGMN PRSC1
Lieferbar
Gene Name	LGMN
Alternative Names	Asparaginyl endopeptidase Protease, cysteine 1 Gene namesi Name:LGMN PRSC1
Uniprot	Q4R4T8
Source	E.coli
Expression Region	18-323aa
AA Sequence	VPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHA YQIIHRNGIPDEQIVVMMYDDIAYSEDNPTPGIVI NRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAE AVKGIGSGKVLKSGPQDHVFVYFTDHGSTGILVFP NEDLHVKDLNETIYYMYKHKMYRKMVFYIEACESG SMMNHLPDNINVYATTAANPRESSYACYYDEKRST YLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT NTSHVMQYGNKTISTMKVMQFQGMKHKASSPLSLP PVTHLDLTPSPDVPLTIMKRKLMNTN
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	39.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system
Function	Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system (By similarity).
Subcellular location	Lysosome
Protein Families	Peptidase C13 family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 31.01.2025

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail