Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial

BK channel (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K(VCA)alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (Slowpoke homolog) (Slo homolog) (hSlo) (KCNMA) (SLO)

E.coli

VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHN ISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVK IESADACLILANKYCADPDAEDASNIMRVISIKNY HPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAIC LAELKLGFIA

Tag-Free

>85% as determined by SDS-PAGE.

Not tested

Ice packs

1 year

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin and charybdotoxin.