ArtNr |
BM-RPC26204-1mg |
Hersteller |
Biomatik
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Actin-binding protein 280 (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin) (FLN-A) (FLN) (FLN1) |
Similar products |
Actin-binding protein 280 (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin) (FLN-A) (FLN) (FLN1) |
Lieferbar |
|
Gene Name |
FLNA |
Alternative Names |
Actin-binding protein 280 (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin) (FLN-A) (FLN) (FLN1) |
Uniprot |
P21333 |
Source |
E.coli |
Expression Region |
2-274aa |
AA Sequence |
SSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLA EDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDL SDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLEN VSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLI WTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWI QNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCP DWDSWDASKPVTNAREAMQQADDWLGIPQVITPEE IVDPNVDEHSVMTYLSQFPKAKLKPGAP |
Sequence Info |
Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
38.0 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Promotes orthogonal branching of actin filaments and links actin filaments to membrane glycoproteins. Anchors various transmembrane proteins to the actin cytoskeleton and serves as a scaffold for a wide range of cytoplasmic signaling proteins. Interaction with FLNA may allow neuroblast migration from the ventricular zone into the cortical plate. Tethers cell surface-localized furin, modulates its rate of internalization and directs its intracellular trafficking. Involved in ciliogenesis. Plays a role in cell-cell contacts and adherens junctions during the development of blood vessels, heart and brain organs. Plays a role in platelets morphology through interaction with SYK that regulates ITAM- and ITAM-like-containing receptor signaling, resulting in by platelet cytoskeleton organization maintenance. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.