« Zurück
Home /
Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial

Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial

ArtNr	BM-RPC25986-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Oncology By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Autophagy Cardiovascular Research Ischemia & Reperfusion Injury By Organ Colorectal Cancer Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Gene Name	BCL2
Uniprot	P10415
Source	E.coli
Expression Region	2-211aa
AA Sequence	AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVG AAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSP LQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSR RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG VNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALW MTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Sequence Info	Partial
Tag Info	C-terminal 10xHis-tagged
Theoretical MW	25.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
Function	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
Involvement in disease	A chromosomal aberration involving BCL2 has been found in chronic lymphatic leukemia. Translocation t(14; 18)(q32; q21) with immunoglobulin gene regions. BCL2 mutations found in non-Hodgkin lymphomas carrying the chromosomal translocation could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.
Subcellular location	Mitochondrion outer membrane, Single-pass membrane protein, Nucleus membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families	Bcl-2 family
Tissue Specificity	Expressed in a variety of tissues.
Paythway	Estrogensignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 24.04.2025

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern