Vergleich

Recombinant Human Transcription activator BRG1 (SMARCA4), partial

ArtNr BM-RPC25894-1mg
Hersteller Biomatik
Menge 1mg
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Short name: BAF190A Mitotic growth and transcription activator Protein BRG-1 Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A
Similar products ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Short name: BAF190A Mitotic growth and transcription activator Protein BRG-1 Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A
Lieferbar
Gene Name
SMARCA4
Alternative Names
ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Short name: BAF190A Mitotic growth and transcription activator Protein BRG-1 Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4
Uniprot
P51532
Source
E.coli
Expression Region
808-1092aa
AA Sequence
IIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARR AFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKY MIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGT PLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPF AMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKK EVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVL LTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMF QHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDR ILPKL
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
Theoretical MW
37.1 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. SMARCA4/BAF190A may promote neural stem cell self-renewal/proliferation by enhancing Notch-dependent proliferative signals, while concurrently making the neural stem cell insensitive to SHH-dependent differentiating cues (By similarity). Acts as a corepressor of ZEB1 to regulate E-cadherin transcription and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1.
Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. SMARCA4/BAF190A may promote neural stem cell self-renewal/proliferation by enhancing Notch-dependent proliferative signals, while concurrently making the neural stem cell insensitive to SHH-dependent differentiating cues (By similarity). Acts as a corepressor of ZEB1 to regulate E-cadherin transcription and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1.
Involvement in disease
Rhabdoid tumor predisposition syndrome 2 (RTPS2); Coffin-Siris syndrome 4 (CSS4)
Subcellular location
Nucleus
Protein Families
SNF2/RAD54 helicase family
Tissue Specificity
Colocalizes with ZEB1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen