« Zurück
Home /
Recombinant Human N (4)- (beta-N-acetylglucosaminyl)-L-asparaginase (AGA), partial

Recombinant Human N (4)- (beta-N-acetylglucosaminyl)-L-asparaginase (AGA), partial

ArtNr	BM-RPC25829-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Aspartylglucosaminidase,Glycosylasparaginase,N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase
Similar products	N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase, Aspartylglucosaminidase, Glycosylasparaginase
Lieferbar
Gene Name	AGA
Alternative Names	Aspartylglucosaminidase, Glycosylasparaginase, N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase
Uniprot	P20933
Source	E.coli
Expression Region	206-346aa
AA Sequence	TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPI PGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEY MRRGEDPTIACQKVISRIQKHFPEFFGAVICANVT GSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDC
Sequence Info	Partial
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	31.1 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.
Function	Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.
Involvement in disease	Aspartylglucosaminuria (AGU)
Subcellular location	Lysosome
Protein Families	Ntn-hydrolase family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 21 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail