ArtNr |
BM-RPC25666-1mg |
Hersteller |
Biomatik
|
Menge |
1 mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Host |
E.coli |
Konjugat/Tag |
Unconjugated |
Purity |
>85% by SDS-PAGE |
Sequence |
QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYG |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Collagen/fibrinogen domain-containing lectin 3 p35Collagen/fibrinogen domain-containing protein 3Hakata antigenFCNH, HAKA1 |
Similar products |
HAKA1, Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen FCNH |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Specificity |
Human (Homo sapiens) |
Manufacturer - Category |
Protein |
Manufacturer - Targets |
FCN3 |
Manufacturer - Conjugate / Tag |
Unconjugated, C-Terminal 6Xhis-Tagged |
Shipping Temperature |
Ice packs |
Storage Conditions |
-20°C. Avoid repeated freeze/thaw cycles. |
Molecular Weight (Theoretical) |
34.8kDa |
Manufacturer - Research Area |
Immunology |
Protein Length |
Full Length of Mature Protein |
Protein Type |
Recombinant Protein |
Expression Region |
24~299aa |
Restrictions |
For Research Use Only. Not for use in diagnostic procedures. |
Expiration |
12 months |
Reconstitution |
Refer to the datasheet/CoA included in the product pouch. |
Endotoxin |
Not Tested |
Quality Systems |
This product is manufactured at ISO 9001 certified facilities. |
Quality Guarantee |
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. |
Long Description |
Recombinant Human Ficolin-3 (FCN3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FCN3. Target Synonyms: Collagen/fibrinogen domain-containing lectin 3 p35Collagen/fibrinogen domain-containing protein 3Hakata antigenFCNH, HAKA1. Accession Number: O75636. Expression Region: 24~299aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 34.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
Short Description |
Recombinant Human Ficolin-3 (FCN3) is a purified Recombinant Protein. |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Activity |
Not Tested |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.