« Zurück
Home /
Recombinant Human Mucosal addressin cell adhesion molecule 1 (MADCAM1), partial

Recombinant Human Mucosal addressin cell adhesion molecule 1 (MADCAM1), partial

ArtNr	BM-RPC25660-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name: MAdCAM-1 Short name: hMAdCAM-1
Similar products	Short name: MAdCAM-1 Short name: hMAdCAM-1
Lieferbar
Gene Name	MADCAM1
Alternative Names	Short name: MAdCAM-1 Short name: hMAdCAM-1
Uniprot	Q13477
Source	Yeast
Expression Region	19-317aa
AA Sequence	QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACAD RGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSA AGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPA ALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQEL EGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPP LGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPT SPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPE PPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQA GPTQGEVIPTGSSKPAGDQ
Sequence Info	Extracellular Domain
Tag Info	C-terminal 6xHis-tagged
Theoretical MW	33.4 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Function	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Subcellular location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ovaries, testis, heart, placenta, lung, liver, skeletal muscle, kidney or peripheral blood leukocytes.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 31.01.2025

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail