« Zurück
Home /
Recombinant Human Glutathione S-transferase P (GSTP1)

Recombinant Human Glutathione S-transferase P (GSTP1)

ArtNr	BM-RPC25658-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GST class-piGSTP1-1
Similar products	GST class-piGSTP1-1
Lieferbar
Gene Name	GSTP1
Alternative Names	GST class-piGSTP1-1
Uniprot	P09211
Source	Yeast
Expression Region	2-210aa
AA Sequence	PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTV ETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILR HLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYIS LIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGK TFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPL LSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	25.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Subcellular location	Cytoplasm, Mitochondrion, Nucleus
Protein Families	GST superfamily, Pi family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 30.08.2024

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail