ArtNr |
BM-RPC25643-1mg |
Hersteller |
Biomatik
|
Menge |
1 mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Host |
E.coli |
Konjugat/Tag |
Unconjugated |
Purity |
>90% by SDS-PAGE |
Sequence |
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
GST class-piGSTP1-1 |
Similar products |
GST class-piGSTP1-1 |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Specificity |
Human (Homo sapiens) |
Manufacturer - Category |
Protein |
Manufacturer - Targets |
GSTP1 |
Manufacturer - Conjugate / Tag |
Unconjugated, N-Terminal 10Xhis-Tagged |
Shipping Temperature |
Ice packs |
Storage Conditions |
-20°C. Avoid repeated freeze/thaw cycles. |
Molecular Weight (Theoretical) |
28.2kDa |
Manufacturer - Research Area |
Metabolism |
Protein Length |
Full Length of Mature Protein |
Protein Type |
Recombinant Protein |
Expression Region |
2~210aa |
Restrictions |
For Research Use Only. Not for use in diagnostic procedures. |
Expiration |
12 months |
Reconstitution |
Refer to the datasheet/CoA included in the product pouch. |
Endotoxin |
Not Tested |
Quality Systems |
This product is manufactured at ISO 9001 certified facilities. |
Quality Guarantee |
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. |
Long Description |
Recombinant Human Glutathione S-transferase P (GSTP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GSTP1. Target Synonyms: GST class-piGSTP1-1. Accession Number: P09211. Expression Region: 2~210aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
Short Description |
Recombinant Human Glutathione S-transferase P (GSTP1) is a purified Recombinant Protein. |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Activity |
Not Tested |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.