« Zurück
Home /
Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial

ArtNr	BM-RPC25600-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Adenocarcinoma
Typ	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-a
Similar products	Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-a
Lieferbar
Gene Name	EPCAM
Alternative Names	Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen: CD326
Uniprot	P16422
Source	E.coli
Expression Region	24-265aa
AA Sequence	QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVI CSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDG LYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTD KDTEITCSERVRTYWIIIELKHKAREKPYDSKSLR TALQKEITTRYQLDPKFITSILYENNVITIDLVQN SSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDL TVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Sequence Info	Partial
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	43.4 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Function	May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Involvement in disease	Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)
Subcellular location	Lateral cell membrane, Single-pass type I membrane protein, Cell junction, tight junction
Protein Families	EPCAM family
Tissue Specificity	Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 27.12.2024

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail