« Zurück
Home /
Recombinant Human Bone morphogenetic protein 7 (BMP7)

Recombinant Human Bone morphogenetic protein 7 (BMP7)

ArtNr	BM-RPC25587-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Osteogenic protein 1,OP-1INN: Eptotermin alfa
Similar products	Osteogenic protein 1, OP-1INN: Eptotermin alfa
Lieferbar
Gene Name	BMP7
Alternative Names	Osteogenic protein 1, OP-1INN: Eptotermin alfa
Uniprot	P18075
Source	E.coli
Expression Region	293-431aa
AA Sequence	STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQR QACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGE CAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCA PTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	19.7 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Function	Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Subcellular location	Secreted
Protein Families	TGF-beta family
Tissue Specificity	Expressed in the kidney and bladder. Lower levels seen in the brain.
Paythway	Hipposignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 22 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail