« Zurück
Home /
Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2)

Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2)

ArtNr	BM-RPC25583-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ATP-dependent RNA helicase eIF4A-2
Similar products	ATP-dependent RNA helicase eIF4A-2
Lieferbar
Gene Name	EIF4A2
Alternative Names	ATP-dependent RNA helicase eIF4A-2
Uniprot	Q14240
Source	E.coli
Expression Region	1-407aa
AA Sequence	MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNF DDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG YDVIAQAQSGTGKTATFAISILQQLEIEFKETQAL VLAPTRELAQQIQKVILALGDYMGATCHACIGGTN VRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPK WIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV VLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLE GIKQFYINVEREEWKLDTLCDLYETLTITQAVIFL NTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVI MREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRIL RDIETFYNTTVEEMPMNVADLI
Sequence Info	Full Length
Tag Info	N-terminal GST-tagged
Theoretical MW	73.4 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Function	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Protein Families	DEAD box helicase family, eIF4A subfamily

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 18 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail