ArtNr |
BM-RPC20818-100ug |
Hersteller |
Biomatik
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Constitutive photomorphogenesis protein 1 homolog Short name: hCOP1 RING finger and WD repeat domain protein 2 RING finger protein 200 |
Similar products |
Constitutive photomorphogenesis protein 1 homolog Short name: hCOP1 RING finger and WD repeat domain protein 2 RING finger protein 200 |
Lieferbar |
|
Gene Name |
RFWD2 |
Alternative Names |
Constitutive photomorphogenesis protein 1 homolog Short name: hCOP1 RING finger and WD repeat domain protein 2 RING finger protein 200 |
Uniprot |
Q8NHY2 |
Source |
in vitro E.coli expression system |
Expression Region |
1-731aa |
AA Sequence |
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSP SPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLV APAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSS LGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICF DMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNY VVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHS VSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELL VQKKKQLEAESHAAQLQILMEFLKVARRNKREQLE QIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQF EAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYN STLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRT ASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQ DAVDIHYPENEMTCNSKISCISWSSYHKNLLASSD YEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMD PKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCC VKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVF KGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKP YCLRSFKGHINEKNFVGLASNGDYIACGSENNSLY LYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFV SAVCWRALPDGESNVLIAANSQGTIKVLELV |
Sequence Info |
Full Length |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
84.5 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation. |
Function |
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation. Upon binding to TRIB1, ubiquitinates CEBPA, which lacks a canonical COP1-binding motif (Probable). |
Subcellular location |
Nucleus speckle, Cytoplasm |
Protein Families |
COP1 family |
Tissue Specificity |
Ubiquitously expressed at low level. Expressed at higher level in testis, placenta, skeletal muscle and heart. |
Paythway |
p53signalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.