« Zurück
Home /
Recombinant Human Transmembrane protein PVRIG (PVRIG)

Recombinant Human Transmembrane protein PVRIG (PVRIG)

ArtNr	BM-RPC20803-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD112 receptor Short name: CD112R Poliovirus receptor-related immunoglobulin domain-containing protein C7orf15
Similar products	CD112 receptor Short name: CD112R Poliovirus receptor-related immunoglobulin domain-containing protein C7orf15
Lieferbar
Gene Name	PVRIG
Alternative Names	CD112 receptor Short name: CD112R Poliovirus receptor-related immunoglobulin domain-containing protein C7orf15
Uniprot	Q6DKI7
Source	in vitro E.coli expression system
Expression Region	1-326aa
AA Sequence	MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTL CVTAGTPEVWVQVRMEATELSSFTIRCGFLGSGSI SLVTVSWGGPNGAGGTTLAVLHPERGIRQWAPARQ ARWETQSSISLILEGSGASSPCANTTFCCKFASFP EGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGI LGVSGVLLFGCVYLLHLLRRHKHRPAPRLQPSRTS PQAPRARAWAPSQASQAALHVPYATINTSCRPATL DTAHPHGGPSWWASLPTHAAHRPQGPAAWASTPIP ARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRG PRAMEGPLGVR
Sequence Info	Full Length
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	50.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cell surface receptor for NECTIN2. May act as a coinhibitory receptor that suppresses T-cell receptor-mediated signals. Following interaction with NECTIN2, inhibits T-cell proliferation. Competes with CD226 for NECTIN2-binding.
Function	Cell surface receptor for NECTIN2. May act as a coinhibitory receptor that suppresses T-cell receptor-mediated signals. Following interaction with NECTIN2, inhibits T-cell proliferation. Competes with CD226 for NECTIN2-binding.
Subcellular location	Cell membrane, Multi-pass membrane protein
Tissue Specificity	Expressed in some types of immune cells. Expressed at low levels on the surface of freshly isolated T-cells and natural killer (NK) cells, predominantly on CD8+ T-cells (mainly memory/effector, but not naive cells) and on both CD16+ and CD16- NK cells. T-cell expression levels are variable among individuals. Not detected in B-cells, naive or helper T-cells, monocytes, nor neutrophils (at protein level). Not detected in dendritic cells.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 30.08.2024

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail