Vergleich

Recombinant Human Bone marrow proteoglycan (PRG2), partial

ArtNr BM-RPC20747-50ug
Hersteller Biomatik
Menge 50ug
Kategorie
Typ Proteins Recombinant
Specific against Human
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name(s): Pregnancy-associated major basic protein
Similar products Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name(s): Pregnancy-associated major basic protein
Lieferbar
Gene Name
PRG2
Alternative Names
Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name(s): Pregnancy-associated major basic protein
Uniprot
P13727
Source
in vitro E.coli expression system
Expression Region
106-222aa
AA Sequence
TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWV DGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA HCLRRLPFICSY
Sequence Info
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Theoretical MW
29.8 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Function
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Subcellular location
Bone marrow proteoglycan: Secreted, Note=The proform is secreted, SUBCELLULAR LOCATION: Eosinophil granule major basic protein: Cytoplasmic vesicle, secretory vesicle
Tissue Specificity
High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen