ArtNr |
BM-RPC20746-100ug |
Hersteller |
Biomatik
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP |
Similar products |
Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP |
Lieferbar |
|
Gene Name |
PRG2 |
Alternative Names |
Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP |
Uniprot |
P13727 |
Source |
in vitro E.coli expression system |
Expression Region |
106-222aa |
AA Sequence |
TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWV DGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA HCLRRLPFICSY |
Sequence Info |
Partial |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
17.8 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA. |
Function |
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA. |
Subcellular location |
Bone marrow proteoglycan: Secreted, Note=The proform is secreted, SUBCELLULAR LOCATION: Eosinophil granule major basic protein: Cytoplasmic vesicle, secretory vesicle |
Tissue Specificity |
High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.