ArtNr |
BM-RPC20722-50ug |
Hersteller |
Biomatik
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 rece |
Similar products |
FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 rece |
Lieferbar |
|
Gene Name |
CXCR4 |
Alternative Names |
FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 receptor CD_antigen: CD184 |
Uniprot |
P61073 |
Source |
in vitro E.coli expression system |
Expression Region |
1-356aa |
AA Sequence |
MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFRE ENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQ KKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVAN WYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYL AIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPD FIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMV GLILPGIVILSCYCIIISKLSHSKGHQKRKALKTT VILILAFFACWLPYYIGISIDSFILLEIIKQGCEF ENTVHKWISITEALAFFHCCLNPILYAFLGAKFKT SAQHALTSVSRGSSLKILSKGKRGGHSSVSTESES SSFHSS |
Sequence Info |
Full Length of Isoform 2 |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Theoretical MW |
56.2 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.10 Publications (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus (PubMed:9427609, PubMed:10074122, PubMed:10756055). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed:11276205) |
Function |
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. |
Involvement in disease |
WHIM syndrome (WHIMS) |
Subcellular location |
Cell membrane, Multi-pass membrane protein, Cell junction, Early endosome, Late endosome, Lysosome |
Protein Families |
G-protein coupled receptor 1 family |
Tissue Specificity |
Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested. |
Paythway |
Chemokinesignalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.