Vergleich

Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)

ArtNr BM-RPC20722-50ug
Hersteller Biomatik
Menge 50ug
Kategorie
Typ Proteins Recombinant
Specific against Human
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 rece
Similar products FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 rece
Lieferbar
Gene Name
CXCR4
Alternative Names
FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 receptor CD_antigen: CD184
Uniprot
P61073
Source
in vitro E.coli expression system
Expression Region
1-356aa
AA Sequence
MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFRE ENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQ KKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVAN WYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYL AIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPD FIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMV GLILPGIVILSCYCIIISKLSHSKGHQKRKALKTT VILILAFFACWLPYYIGISIDSFILLEIIKQGCEF ENTVHKWISITEALAFFHCCLNPILYAFLGAKFKT SAQHALTSVSRGSSLKILSKGKRGGHSSVSTESES SSFHSS
Sequence Info
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Theoretical MW
56.2 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.10 Publications (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus (PubMed:9427609, PubMed:10074122, PubMed:10756055). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed:11276205)
Function
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.
Involvement in disease
WHIM syndrome (WHIMS)
Subcellular location
Cell membrane, Multi-pass membrane protein, Cell junction, Early endosome, Late endosome, Lysosome
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested.
Paythway
Chemokinesignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen